PDB entry 4ipz

View 4ipz on RCSB PDB site
Description: SmBz bound to Cyclophilin A
Class: Isomerase/isomerase inhibitor
Keywords: Cyclophilin fold, Peptidyl-prolyl Isomerase, Cyclosporine A, Isomerase-isomerase inhibitor complex
Deposited on 2013-01-10, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ipza_
  • Chain 'B':
    Compound: SmBz, CYCLOPHILIN A derivative
    Species: TOLYPOCLADIUM INFLATUM [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
      • engineered mutation (6)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ipzA (A:)
    mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
    mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
    wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ipzA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygkfedenfilkhtgpgilsmanagpntngsqffictaktewl
    dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    No sequence available.