PDB entry 4ipl

View 4ipl on RCSB PDB site
Description: The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae
Class: hydrolase
Keywords: hydrolase
Deposited on 2013-01-10, released 2013-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: Streptococcus pneumoniae [TaxId:170187]
    Gene: bglA-2, SP_0578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ipla_
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase
    Species: Streptococcus pneumoniae [TaxId:170187]
    Gene: bglA-2, SP_0578
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4iplb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iplA (A:)
    hhhhhhssglvprgshmtifpddflwggavaanqvegaynedgkglsvqdvlpkgglgea
    tenptednlkligidfyhkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglky
    ydelfdelhahgieplvtlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvk
    ywltfnevnsvlelpftsggidipkenlskqelyqaihhelvasslvtkiareinsefkv
    gcmvlampaypmtpnpkdvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaa
    edaellknytvdflsfsyymsvtqsalptqynsgegniigglvnpylessewgwqidpig
    lriilnryydryqiplfivenglgakdqlikdelnnltvqddyriqymkehllqvaealq
    dgveimgytswgcidcvsmstaqlskrygliyvdrnddgsgtlnrykkmsftwykevies
    ngeslfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iplA (A:)
    tifpddflwggavaanqvegaynedgkglsvqdvlpkgglgeatenptednlkligidfy
    hkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglkyydelfdelhahgieplv
    tlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvkywltfnevnsvlelpft
    sggidipkenlskqelyqaihhelvasslvtkiareinsefkvgcmvlampaypmtpnpk
    dvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaaedaellknytvdflsfs
    yymsvtqsalptqyglvnpylessewgwqidpiglriilnryydryqiplfivenglgak
    dqlikdelnnltvqddyriqymkehllqvaealqdgveimgytswgcidcvsmstaqlsk
    rygliyvdrnddgsgtlnrykkmsftwykeviesngeslf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iplB (B:)
    hhhhhhssglvprgshmtifpddflwggavaanqvegaynedgkglsvqdvlpkgglgea
    tenptednlkligidfyhkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglky
    ydelfdelhahgieplvtlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvk
    ywltfnevnsvlelpftsggidipkenlskqelyqaihhelvasslvtkiareinsefkv
    gcmvlampaypmtpnpkdvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaa
    edaellknytvdflsfsyymsvtqsalptqynsgegniigglvnpylessewgwqidpig
    lriilnryydryqiplfivenglgakdqlikdelnnltvqddyriqymkehllqvaealq
    dgveimgytswgcidcvsmstaqlskrygliyvdrnddgsgtlnrykkmsftwykevies
    ngeslfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iplB (B:)
    tifpddflwggavaanqvegaynedgkglsvqdvlpkgglgeatenptednlkligidfy
    hkykedislfsemgfnvfrtsiawsrifpkgdeeepneaglkyydelfdelhahgieplv
    tlshyetplylarkyhgwvdrrmihfyekfartvlerykdkvkywltfnevnsvlelpft
    sggidipkenlskqelyqaihhelvasslvtkiareinsefkvgcmvlampaypmtpnpk
    dvwatheyenlnylfsdvhvrgyypnyakryfkendiniefaaedaellknytvdflsfs
    yymsvtqsalpglvnpylessewgwqidpiglriilnryydryqiplfivenglgakdql
    ikdelnnltvqddyriqymkehllqvaealqdgveimgytswgcidcvsmstaqlskryg
    liyvdrnddgsgtlnrykkmsftwykeviesngeslf