PDB entry 4ioi

View 4ioi on RCSB PDB site
Description: Meditope-enabled trastuzumab in complex with CQFDLSTRRLKC
Class: immune system
Keywords: monoclonal antibody, immune system, cancer immunotherapy
Deposited on 2013-01-07, released 2013-10-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.177
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trastuzumab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOI (0-213)
    Domains in SCOPe 2.03: d4ioia1, d4ioia2
  • Chain 'B':
    Compound: Trastuzumab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOI (0-End)
  • Chain 'C':
    Compound: meditope
    Database cross-references and differences (RAF-indexed):
    • PDB 4IOI (0-11)
  • Chain 'E':
    Compound: protein l
    Species: Finegoldia magna [TaxId:1260]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51918 (3-64)
      • expression tag (2)
      • engineered mutation (17)
      • engineered mutation (38)
      • engineered mutation (56-58)
    Domains in SCOPe 2.03: d4ioie_
  • Chain 'H':
    Compound: Immunoglobulin G-binding protein A
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: spa, SAV0111
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A015 (4-54)
      • expression tag (2-3)
    Domains in SCOPe 2.03: d4ioih_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ioiA (A:)
diqmtqspillsasvgdrvtitcrasqdvntavawyqqrtngsprlliysasflysgvps
rfsgsrsgtdftltisslqpediadyycqqhyttpptfgagtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >4ioiE (E:)
sgsevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmn
ikfag

    Sequence, based on observed residues (ATOM records): (download) 
    >4ioiE (E:)
sevtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnik
fag

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >4ioiH (H:)
sgsynkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

    Sequence, based on observed residues (ATOM records): (download) 
    >4ioiH (H:)
synkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa