PDB entry 4inz

View 4inz on RCSB PDB site
Description: The crystal structure of M145A mutant of an epoxide hydrolase from Bacillus megaterium
Class: hydrolase
Keywords: a/b hydrolase fold, enzymatic resolution, HYDROLASE
Deposited on 2013-01-07, released 2014-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble epoxide hydrolase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9BEX6 (Start-303)
      • engineered mutation (161)
    Domains in SCOPe 2.06: d4inza_
  • Chain 'B':
    Compound: Soluble epoxide hydrolase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9BEX6 (Start-303)
      • engineered mutation (161)
    Domains in SCOPe 2.06: d4inzb_
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4inzA (A:)
    gshmasmtggqqmgrgsmskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqide
    fsndfhtvaldlrgynlsekpsglesyeidvlvedirqvieglgyssctlvvhdwgagig
    wtfayrypeyvqkliafngphpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfs
    glrklvidpgvkkgyltaddvqaymnswengsvlsmlsyyrnlkifteedlrrkslfple
    eevlnipvqiiwgnqdptfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwn
    flnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4inzA (A:)
    skqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynls
    ekpsglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliafn
    gphpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfsglrklvidpgvkkgylta
    ddvqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdpt
    fmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4inzB (B:)
    gshmasmtggqqmgrgsmskqyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqide
    fsndfhtvaldlrgynlsekpsglesyeidvlvedirqvieglgyssctlvvhdwgagig
    wtfayrypeyvqkliafngphpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfs
    glrklvidpgvkkgyltaddvqaymnswengsvlsmlsyyrnlkifteedlrrkslfple
    eevlnipvqiiwgnqdptfmpenldgieeyvpnisvhrlaeashapqhekpqevnnvmwn
    flnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4inzB (B:)
    qyinvngvnlhyiskgqgelmlflhgfpdfshiwrhqidefsndfhtvaldlrgynlsek
    psglesyeidvlvedirqvieglgyssctlvvhdwgagigwtfayrypeyvqkliafngp
    hpytfmrelrtnknqqkaseyakwfqkqevqdymerdnfsglrklvidpgvkkgyltadd
    vqaymnswengsvlsmlsyyrnlkifteedlrrkslfpleeevlnipvqiiwgnqdptfm
    penldgieeyvpnisvhrlaeashapqhekpqevnnvmwnflnk