PDB entry 4int

View 4int on RCSB PDB site
Description: Yeast 20S proteasome in complex with the vinyl sulfone LU122
Class: hydrolase/hydrolase inhibitor
Keywords: UPS, drug discovery, irreversible inhibition, Ntn hydrolase, non-lysosomal protein breakdown, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2013-01-06, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inta_
  • Chain 'B':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intb_
  • Chain 'C':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intc_
  • Chain 'D':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intd_
  • Chain 'E':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inte_
  • Chain 'F':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intf_
  • Chain 'G':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intg_
  • Chain 'H':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inth_
  • Chain 'I':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inti_
  • Chain 'J':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intj_
  • Chain 'K':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intk_
  • Chain 'L':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intl_
  • Chain 'M':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intm_
  • Chain 'N':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intn_
  • Chain 'O':
    Compound: Proteasome component Y7
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4into_
  • Chain 'P':
    Compound: Proteasome component Y13
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intp_
  • Chain 'Q':
    Compound: Proteasome component PRE6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intq_
  • Chain 'R':
    Compound: Proteasome component PUP2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intr_
  • Chain 'S':
    Compound: Proteasome component PRE5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ints_
  • Chain 'T':
    Compound: Proteasome component C1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intt_
  • Chain 'U':
    Compound: Proteasome component C7-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intu_
  • Chain 'V':
    Compound: Proteasome component PUP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intv_
  • Chain 'W':
    Compound: Proteasome component PUP3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intw_
  • Chain 'X':
    Compound: Proteasome component C11
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intx_
  • Chain 'Y':
    Compound: Proteasome component PRE2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4inty_
  • Chain 'Z':
    Compound: Proteasome component C5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4intz_
  • Chain 'a':
    Compound: Proteasome component PRE4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome component PRE3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 1G5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intA (A:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4intB (B:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intB (B:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4intC (C:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intC (C:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4intD (D:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intD (D:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4intE (E:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intE (E:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4intF (F:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intF (F:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4intG (G:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intG (G:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4intH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intH (H:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4intI (I:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intI (I:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intJ (J:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intK (K:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intL (L:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intM (M:)
    tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
    qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
    sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
    mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intN (N:)
    tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
    yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
    klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
    agverlifypdeyeql
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intO (O:)
    mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
    lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
    atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
    deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
    qeindrleal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4intP (P:)
    mgsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqd
    tsteklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikq
    gytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdy
    kddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilv
    ktgitkkdedeeadedmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intP (P:)
    gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
    steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
    ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
    ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
    tgit
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4intQ (Q:)
    msgydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtrit
    pskvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqry
    tqsggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknyd
    rkeppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqek
    qeqqeqdkkkksnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intQ (Q:)
    gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
    kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
    sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
    eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
    q
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4intR (R:)
    mfltrseydrgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratsplle
    sdsiekiveidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdla
    lrfgegasgeerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaq
    aellnewhssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaeli
    kelkekeaaespeeadvems
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intR (R:)
    drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
    eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
    geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
    ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
    ae
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4intS (S:)
    mfrnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyq
    kkiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqknt
    qsyggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfi
    kidgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intS (S:)
    frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
    kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
    syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
    idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4intT (T:)
    mtsigtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllv
    pqknvkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyv
    qahtlynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklv
    dhhpeglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeai
    dfaqkeingdddededdsdnvmssddenapvatnanattdqegdihle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intT (T:)
    gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
    vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
    lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
    eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
    kein
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4intU (U:)
    msgaaaasaagydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvp
    dklldpttvsyifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakr
    manlsqiytqraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeitt
    nlenhfkkskidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaen
    ieerlvaiaeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intU (U:)
    agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
    syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
    qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
    kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
    eqd
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4intV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqeeqvdita
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intV (V:)
    ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
    snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
    vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
    gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4intW (W:)
    msdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdv
    ttlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpf
    iagfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdal
    sgwgavvyiikkdevvkrylkmrqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4intW (W:)
    sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
    tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
    agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
    gwgavvyiikkdevvkrylkmrqd
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intX (X:)
    mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
    qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
    ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
    vkivdkdgirqvddfqaq
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intY (Y:)
    tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
    sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
    rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
    tedgwiyhgnhdvgelfwkvkeeegsfnnvig
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4intZ (Z:)
    qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
    gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
    avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
    iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.