PDB entry 4in7

View 4in7 on RCSB PDB site
Description: (M)L214N mutant of the Rhodobacter sphaeroides Reaction Center
Class: oxidoreductase
Keywords: Electron Transfer, Chromatophore, Oxidoreductase
Deposited on 2013-01-04, released 2013-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4in7h1, d4in7h2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4in7l_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y9 (1-302)
      • engineered mutation (214)
    Domains in SCOPe 2.07: d4in7m_
  • Heterogens: GOL, K, GGD, BCL, LDA, U10, PO4, HTO, FE, BPH, SPO, CDL, PC1, MG

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4in7H (H:)
    hhhhhhmvgvtafgnfdlaslaiysfwiflagliyylqtenmregyplenedgtpaanqg
    pfplpkpktfilphgrgtltvpgpesedrpialartavsegfphaptgdpmkdgvgpasw
    varrdlpeldghghnkikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeq
    marflevelkdgstrllpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkic
    gyvagglmyaapkrksvvaamlaeya
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in7H (H:)
    dlaslaiysfwiflagliyylqtenmregyplenedgtpaanqgpfplpkpktfilphgr
    gtltvpgpesedrpialartavsegfphaptgdpmkdgvgpaswvarrdlpeldghghnk
    ikpmkaaagfhvsagknpiglpvrgcdleiagkvvdiwvdipeqmarflevelkdgstrl
    lpmqmvkvqsnrvhvnalssdlfagiptiksptevtlleedkicgyvagglmyaapkrks
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4in7L (L:)
    mallsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtw
    npqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipf
    afafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisf
    fftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllsls
    avffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in7L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4in7M (M:)
    maeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvls
    lfsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwlias
    ffmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygi
    fshldwtnnfslvhgnlfynpfhglsiaflygsanlfamhgatilavsrfggereleqia
    drgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgq
    nhgmapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in7M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsanlfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg