PDB entry 4in5

View 4in5 on RCSB PDB site
Description: (M)L214G mutant of the Rhodobacter sphaeroides Reaction Center
Class: Oxidoreductase
Keywords: Electron Transfer, Chromatophore, Oxidoreductase
Deposited on 2013-01-04, released 2013-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL, puhA
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufL, puhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4in5l_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: pufM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0Y9
      • engineered mutation (214)
    Domains in SCOPe 2.02: d4in5m_
  • Heterogens: LDA, BPH, U10, BCL, PO4, HTO, GOL, FE, SPO, PC1, K, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4in5L (L:)
    mallsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtw
    npqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipf
    afafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisf
    fftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllsls
    avffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in5L (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4in5M (M:)
    maeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvls
    lfsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwlias
    ffmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygi
    fshldwtnnfslvhgnlfynpfhglsiaflygsaglfamhgatilavsrfggereleqia
    drgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgq
    nhgmapl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4in5M (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsaglfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hg