PDB entry 4im4

View 4im4 on RCSB PDB site
Description: Multifunctional cellulase, xylanase, mannanase
Class: hydrolase
Keywords: cellulase, xylanase, mannanase, multifunction, Endo-1,4-beta-glucanase, biomass degradation, HYDROLASE
Deposited on 2013-01-02, released 2014-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4a_
  • Chain 'B':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4b_
  • Chain 'C':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4c_
  • Chain 'D':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4d_
  • Chain 'E':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4e_
  • Chain 'F':
    Compound: endoglucanase e
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4im4f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4A (A:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4B (B:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4C (C:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4D (D:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4E (E:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4im4F (F:)
    gmrdisaidlvkeikigwnlgntldaptetawgnprttkamiekvremgfnavrvpvtwd
    thigpapdykideawlnrveevvnyvldcgmyaiinlhhdntwiiptyaneqrskeklvk
    vweqiatrfkdyddhllfetmneprevgspmewmggtyenrdvinrfnlavvntirasgg
    nndkrfilvptnaatgldvalndlvipnndsrvivsihayspyffamdvngtsywgsdyd
    kasltseldaiynrfvkngraviigefgtidknnlssrvahaehyareavsrgiavfwwd
    ngyynpgdaetyallnrktlswyypeivqalmrgag