PDB entry 4ilg

View 4ilg on RCSB PDB site
Description: Crystal structure of Aar2p in complex with the Prp8p RNaseH and Jab1/MPN domains
Class: splicing
Keywords: U5 snRNP assembly, Aar2, Prp8, SPLICING
Deposited on 2012-12-31, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A1 cistron-splicing factor AAR2
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: AAR2, YBL074C, YBL06.06, YBL0611
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32357 (0-341)
      • engineered mutation (152-153)
    Domains in SCOPe 2.07: d4ilga1, d4ilga2
  • Chain 'B':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33334 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4ilgb1, d4ilgb2
  • Chain 'C':
    Compound: Pre-mRNA-splicing factor 8
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: PRP8, DBF3, DNA39, RNA8, SLT21, USA2, YHR165C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ilgc_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ilgA (A:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenelsssssdpahslnytvinfksreairpgh
    emedfldksyylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamielicss
    atvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqknslhntekimenky
    pellgkdneddaliygisdeerddeddehnptivgglyyqrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilgA (A:)
    mntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywf
    dcrmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltef
    vqmdkirkivrkdenqfsyvdssmttvqenelsssssdpahslnytvinfksreairpgh
    emedfldksyylntvmlqgifknssnyfgelqfaflnamffgnygsslqwhamielicss
    atvpkhmldkldeilyyqiktlpeqysdillnervwniclyssfqknslhntekimenky
    pellddehnptivgglyyqrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ilgB (B:)
    gamnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
    iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
    niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
    ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
    altqteikdiilgqnika
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilgB (B:)
    amnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflki
    ihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpn
    iairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllr
    alktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisa
    ltqteikdiilg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ilgC (C:)
    gamssknewrksaiantllylrlkniyvsaddfveeqnvyvlpknllkkfieisdvkiqv
    aafiygmsakdhpkvkeiktvvlvpqlghvgsvqisnipdigdlpdteglellgwihtqt
    eelkfmaasevathsklfadkkrdcidisifstpgsvslsaynltdegyqwgeenkdimn
    vlsegfeptfsthaqlllsdritgnfiipsgnvwnytfmgtafnqegdynfkygiplefy
    nemhrpvhflqfselagdeeleaeqidvfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ilgC (C:)
    sknewrksaiantllylrlkniyvsaddfveeqnvyvlpknllkkfieisdvkiqvaafi
    ygmsakdhpkvkeiktvvlvpqlghvgsvqisnipdigdlpdteglellgwihtqteelk
    fmaasevathsklfadkkrdcidisifstpgsvslsaynltdegyqwgeenkdimnvlse
    gfeptfsthaqlllsdritgnfiipsgnvwnytfmgtafnqegdynfkygiplefynemh
    rpvhf