PDB entry 4ile

View 4ile on RCSB PDB site
Description: Structure of human ADP-ribosylation factor-like 8A binding to GDP
Class: transport protein
Keywords: GTPase, MEMBRANE TRAFFICKING, TRANSPORT PROTEIN
Deposited on 2012-12-31, released 2014-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.185
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 8A
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL8A, ARL10B, GIE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96BM9 (Start-182)
      • expression tag (183)
    Domains in SCOPe 2.07: d4ilea1, d4ilea2
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ileA (A:)
    gsmialfnklldwfkalfwkeemeltlvglqysgkttfvnviasgqfnedmiptvgfnmr
    kitkgnvtiklwdiggqprfrsmwerycrgvsaivymvdaadqekieasknelhnlldkp
    qlqgipvlvlgnkrdlpgaldekeliekmnlsaiqdreiccysisckekdniditlqwli
    qhsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ileA (A:)
    klldwfkalfwkeemeltlvglqysgkttfvnviasgqfnedmiptvgfnmrkitkgnvt
    iklwdiggqprfrsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvl
    vlgnkrdlpgaldekeliekmnlsaiqdreiccysisckekdniditlqwliqhsr