PDB entry 4il0

View 4il0 on RCSB PDB site
Description: Crystal structure of GlucDRP from E. coli K-12 MG1655 (EFI target EFI-506058)
Class: lyase
Keywords: TIM-barrel, dehydratase, GlucD, LYASE
Deposited on 2012-12-28, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0a1, d4il0a2
  • Chain 'B':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0b1, d4il0b2
  • Chain 'C':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0c1, d4il0c2
  • Chain 'D':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0d1, d4il0d2
  • Chain 'E':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0e1, d4il0e2
  • Chain 'F':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0f1, d4il0f2
  • Chain 'G':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0g1, d4il0g2
  • Chain 'H':
    Compound: Glucarate dehydratase-related protein
    Species: Escherichia coli [TaxId:511145]
    Gene: gudX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4il0h1, d4il0h2
  • Heterogens: CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4il0A (A:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0A (A:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
    alnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnse
    avvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeai
    slckglndvltyaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlna
    vdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaid
    thwiwqegdcrltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndag
    pmqylipgwtfdrkrpvfgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4il0B (B:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0B (B:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
    alnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnse
    avvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeai
    slckglndvltyaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlna
    vdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaid
    thwiwqegdcrltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndag
    pmqylipgwtfdrkrpvfgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4il0C (C:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0C (C:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
    alnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnse
    avvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeai
    slckglndvltyaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlna
    vdipladphfwtlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaid
    thwiwqegdcrltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndag
    pmqylipgwtfdrkrpvfgr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4il0D (D:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0D (D:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhtfelrvnavaaleaalldllgkalnvpvcellgpgkqr
    eaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfk
    dfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvltyaedp
    cgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfwtlsga
    vrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcrltqnp
    leikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrp
    vfgr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4il0E (E:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0E (E:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhlrvnavaaleaalldllgkalnvpvcellgpgkqreai
    tvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfk
    lkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvltyaedpcga
    eqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfwtlsgavrv
    aqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcrltqnplei
    kngkiavpdapglgveldweqvqkaheaykrlpndagpmqylipgwtfdrkrpvfgr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4il0F (F:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0F (F:)
    pvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlvd
    aipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgka
    lnvpvcellgpgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnsea
    vvrlaeasqdrygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeais
    lckglndvltyaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnav
    dipladphfwtlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidt
    hwiwqegdcrltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndagp
    mqylipgwtfdrkrpvfgr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4il0G (G:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0G (G:)
    pvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlvd
    aipmvlgqevarlnkvvqqvhvnavaaleaalldllgkalnvpvcellgpgkqreaitvl
    gylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkg
    gvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqg
    fsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaql
    cddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikng
    kiavpdapglgveldweqvqkaheaykrlparndagpmqylipgwtfdrkrpvfgr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4il0H (H:)
    mgsshhhhhhssglvprgshmatqsspvitdmkvipvaghdsmllniggahnayftrniv
    vltdnaghtgigeapggdviyqtlvdaipmvlgqevarlnkvvqqvhkgnqaadfdtfgk
    gawtfelrvnavaaleaalldllgkalnvpvcellgpgkqreaitvlgylfyigdrtktd
    lpyventpgnhewyqlrhqkamnseavvrlaeasqdrygfkdfklkggvlpgeqeidtvr
    alkkrfpdaritvdpngawlldeaislckglndvltyaedpcgaeqgfsgrevmaefrra
    tglpvatnmiatnwremghavmlnavdipladphfwtlsgavrvaqlcddwgltwgchsn
    nhfdislamfthvgaaapgnptaidthwiwqegdcrltqnpleikngkiavpdapglgve
    ldweqvqkaheaykrlpggarndagpmqylipgwtfdrkrpvfgrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4il0H (H:)
    spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv
    daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk
    alnvpvcellgpgkqreaitvlgylfyigdrtgnhewyqlrhqkamnseavvrlaeasqd
    rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt
    yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw
    tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr
    ltleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtfdrk
    rpvfgr