PDB entry 4iiq

View 4iiq on RCSB PDB site
Description: Crystal structure of a human MAIT TCR in complex with bovine MR1
Class: immune system
Keywords: MHC-class I, Immunoglobulin domain, Immune system, Antigen presentation, Antigen recognition, Cell Membrane
Deposited on 2012-12-20, released 2013-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Human Mucosal Associated Invariant T cell receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IIQ
    Domains in SCOPe 2.05: d4iiqa1, d4iiqa2
  • Chain 'B':
    Compound: Human Mucosal Associated Invariant T cell receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4IIQ
    Domains in SCOPe 2.05: d4iiqb1, d4iiqb2
  • Chain 'C':
    Compound: Beta-2-microglobulin, MHC class I-related protein
    Species: Bos taurus [TaxId:9913]
    Gene: MR1, Bt.63045
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4iiqc1, d4iiqc2, d4iiqc3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iiqA (A:)
    magqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekg
    rfssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpniqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiqA (A:)
    qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
    sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpniqnpdpavyql
    rdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmmdfksnsavawsnksdfaca
    nafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iiqB (B:)
    managvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkg
    evpngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvledl
    knvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqpl
    keqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
    eawgradsaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiqB (B:)
    agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
    ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvledlknv
    fppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeq
    palndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeaw
    gra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iiqC (C:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdlggggsggsgsggggsrthslry
    frlgisepgygipefisagyvdshpitmynsvsqlxepralwmeenlapdhwerytqllr
    gwqqafkvelkqlqhhynhsgfhtyqrmigcelledgsitgflqyaydgqdflifnkdtl
    swmamdnvadiirrvweanrhelqyqknwleeeciawlkrfleygkdalqrteppkvrvn
    hketfpgittlycraygfyppeisinwmkngeeifqdtdyggilpsgdgtyqtwvsveld
    pqngdiyschvehggvhmvlqgfqesetilgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiqC (C:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrrthslryfrlgisepgygipefis
    agyvdshpitmynsvsqlxepralwmeenlapdhwerytqllrgwqqafkvelkqlqhhy
    nhsgfhtyqrmigcelledgsitgflqyaydgqdflifnkdtlswmamdnvadiirrvwe
    anrhelqyqknwleeeciawlkrfleygkdalqrteppkvrvnhkttlycraygfyppei
    sinwmkngeeifqdtdyggilpsgdgtyqtwvsvelqngdiyschvehggvhmvlqgfqe