PDB entry 4ih1

View 4ih1 on RCSB PDB site
Description: Crystal structure of Karrikin Insensitive 2 (KAI2) from Arabidopsis thaliana
Class: hydrolase
Keywords: Karrikin receptor, alpha/beta hydrolase, HYDROLASE
Deposited on 2012-12-18, released 2013-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, alpha/beta fold family protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT4g37470, F6G17.120, kai2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ih1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ih1A (A:)
    mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
    yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
    spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
    mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
    ipsdghlpqlsspdsvipvilrhirndiam
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ih1A (A:)
    mgvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpd
    yfdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisa
    spryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfn
    mrpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvev
    ipsdghlpqlsspdsvipvilrhirndi