PDB entry 4ifs

View 4ifs on RCSB PDB site
Description: Crystal structure of the hSSRP1 Middle domain
Class: transcription, replication
Keywords: Double PH Domain, Histone, chaperone, Nucleus, TRANSCRIPTION, REPLICATION
Deposited on 2012-12-15, released 2014-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FACT complex subunit SSRP1
    Species: Homo sapiens [TaxId:9606]
    Gene: FACT80, SSRP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ifsa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ifsA (A:)
    mghhhhhhgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllph
    kdqrqmffvisldppikqgqtryhflillfskdedisltlnmneeevekrfegrltknms
    gslyemvsrvmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppv
    hirfdeisfvnfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklnikn
    rgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ifsA (A:)
    daicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffv
    isldppikqgqtryhflillfskdedisltlnmneeevekrfegrltknmsgslyemvsr
    vmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppvhirfdeisf
    vnfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklnikn