PDB entry 4ids

View 4ids on RCSB PDB site
Description: Crystal structure of the Delta-pyrroline-5-carboxylate dehydrogenase from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: PruA, delta-pyrroline-5-carboxylic dehydrogenase, aldehyde dehydrogenase, pyrroline-5-carboxylate dehydrogenase, pyrroline-5-carboxylate, dehydrogenation, OXIDOREDUCTASE
Deposited on 2012-12-13, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-1-pyrroline-5-carboxylate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6X0K4 (20-End)
      • expression tag (19)
      • engineered mutation (524)
    Domains in SCOPe 2.07: d4idsa1, d4idsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4idsA (A:)
    mgsshhhhhhssglvprgshmdaitqvpvpanepvhdyapkspertrlrtelasladhpi
    dlphviggrhrmgdgeridvvqphrhaarlgtltnathadaaaaveaamsaksdwaalpf
    deraavflraadllagpwrekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqil
    eqqpisgpgewnridyrpldgfvyaitpfnftsiagnlptapalmgntviwkpsitqtla
    ayltmqlleaaglppgvinlvtgdgfavsdvaladprlagihftgstatfghlwqwvgtn
    igryhsyprlvgetggkdfvvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvw
    qrmgdellakaaelrygditdlsnyggalidqrafvknvdaierakgaaavtvavggeyd
    dsegyfvrptvllsddptdesfvieyfgpllsvhvypderyeqildvidtgsryaltgav
    iaddrqavltaldrlrfaagnfyvndkptgavvgrqpfggargsdtndkagsplnllrwt
    sarsiketfvaatdhiyphmavd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4idsA (A:)
    hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
    vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
    ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
    dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
    lvtgdgfavsdvaladprlagihftgstatfgwqwvgtnigryhsyprlvgetggkdfvv
    ahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygditd
    lsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptdes
    fvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaagn
    fyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyphma
    v