PDB entry 4idl

View 4idl on RCSB PDB site
Description: Low melting temperature Anti-Cholera Toxin Llama VHH domain
Class: immune system
Keywords: v-type immunoglobin fold, Antibody, Cholera Toxin, IMMUNE SYSTEM, Single domain Antibody
Deposited on 2012-12-12, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.207
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single Domain Antibody VHH A9
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4IDL
    Domains in SCOPe 2.07: d4idla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4idlA (A:)
    makvqlqqsgggavqtggslkltclasgntasiramgwyrrapgkqrewvasltttgtad
    ygdfvkgrftisrdnannaatlqmdslkpedtavyycnadgrrfdgarwreyeswgqgtq
    vtissaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4idlA (A:)
    kvqlqqsgggavqtggslkltclasgntasiramgwyrrapgkqrewvasltttgtadyg
    dfvkgrftisrdnannaatlqmdslkpedtavyycnadgrrfdgarwreyeswgqgtqvt
    iss