PDB entry 4id7

View 4id7 on RCSB PDB site
Description: ACK1 kinase in complex with the inhibitor cis-3-[8-amino-1-(4-phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol
Class: transferase/transferase inhibitor
Keywords: Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-12-11, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACK1, TNK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4id7a_
  • Heterogens: 1G0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4id7A (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
    evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
    aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
    capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
    pqdiynvmvqcwahkpedrptfvalrdflleaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4id7A (A:)
    ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkppeamddfirevnam
    hsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmg
    yleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapes
    lktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiy
    nvmvqcwahkpedrptfvalrdflleaq