PDB entry 4id4

View 4id4 on RCSB PDB site
Description: Crystal structure of chimeric beta-lactamase cTEM-17m
Class: hydrolase
Keywords: Beta-lactamase, HYDROLASE
Deposited on 2012-12-11, released 2013-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: 0.116
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM, Beta-lactamase PSE-4
    Species: Escherichia coli, Pseudomonas aeruginosa [TaxId:562, 287]
    Gene: bla, blaT-3, blaT-4, blaT-5, blaT-6, carB1, pse4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4id4a_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4id4A (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw