PDB entry 4ibr

View 4ibr on RCSB PDB site
Description: Crystal structure of stabilized TEM-1 beta-lactamase variant v.13 carrying G238S/E104K mutations
Class: hydrolase
Keywords: beta-lactamase, HYDROLASE
Deposited on 2012-12-09, released 2013-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TEM-94 ES-beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: bla-TEM-94
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62593 (0-262)
      • engineered mutation (16)
      • engineered mutation (26)
      • engineered mutation (78)
      • engineered mutation (94)
      • engineered mutation (156)
      • conflict (158)
      • engineered mutation (175)
      • engineered mutation (212)
      • engineered mutation (237)
    Domains in SCOPe 2.07: d4ibra_
  • Heterogens: CA, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ibrA (A:)
    hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlvkyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
    qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
    sqatmdernrqiaeigaslikhw