PDB entry 4i9w

View 4i9w on RCSB PDB site
Description: Human two pore domain K+ channel TRAAK (K2P4.1) - Fab complex structure
Class: metal transport
Keywords: potassium ion channel, metal transport
Deposited on 2012-12-05, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.203
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel subfamily K member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: K2P4.1, KCNK4, TRAAK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Potassium channel subfamily K member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: K2P4.1, KCNK4, TRAAK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NYG8
      • engineered mutation (103)
  • Chain 'D':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I9W (0-210)
    Domains in SCOPe 2.07: d4i9wd1, d4i9wd2
  • Chain 'E':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I9W (0-216)
  • Chain 'F':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I9W (0-210)
    Domains in SCOPe 2.07: d4i9wf1, d4i9wf2
  • Chain 'G':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I9W (0-End)
  • Heterogens: K, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9wD (D:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9wF (F:)
    qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'G':
    No sequence available.