PDB entry 4i9u

View 4i9u on RCSB PDB site
Description: Crystal structure of rabbit LDHA in complex with a fragment inhibitor AP26256
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: cancer, fragment, inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-05, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ua1, d4i9ua2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ub1, d4i9ub2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9uc1, d4i9uc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ud1, d4i9ud2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ue1, d4i9ue2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9uf1, d4i9uf2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ug1, d4i9ug2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9uh1, d4i9uh2
  • Heterogens: 1E7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i9uA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9uA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarnlvqrnvnifkfiipnvvkysp
    hckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalschgwi
    lgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkgytt
    waiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkvtlt
    seeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9uB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9uC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9uD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9uE (E:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i9uF (F:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9uF (F:)
    aalkdqlihnllkevpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemm
    dlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhal
    schgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevik
    lkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdv
    vkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4i9uG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9uG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagaesrlnlvqrnvnifkfiipnvvk
    ysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalsch
    gwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkg
    yttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkv
    tltseeeahlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4i9uH (H:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9uH (H:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagaesrlnlvqrnvnifkfiipnvvk
    ysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalsch
    gwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkg
    yttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkv
    tltseeeahlkksadtlwgiqkelqf