PDB entry 4i9h

View 4i9h on RCSB PDB site
Description: Crystal structure of rabbit LDHA in complex with AP28669
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: cancer, inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2012-12-05, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.207
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ha1, d4i9ha2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hb1, d4i9hb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hc1, d4i9hc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hd1, d4i9hd2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9he1, d4i9he2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hf1, d4i9hf2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hg1, d4i9hg2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9hh1, d4i9hh2
  • Heterogens: 1E4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i9hA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqlnlvqrnvnifkfiipnvvky
    sphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalschg
    wilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkgy
    ttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkvt
    ltseeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i9hB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqsrlnlvqrnvnifkfiipnvv
    kysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalsc
    hgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklk
    gyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvk
    vtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i9hC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagargesrlnlvqrnvnifkfiipnv
    vkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhals
    chgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevikl
    kgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvv
    kvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9hD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i9hE (E:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i9hF (F:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hF (F:)
    aalkdqlihnllkevpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemm
    dlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhal
    schgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevik
    lkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdv
    vkvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4i9hG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hG (G:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarlnlvqrnvnifkfiipnvvkys
    phckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalschgw
    ilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkgyt
    twaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdvvkvtl
    tseeeahlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4i9hH (H:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9hH (H:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqesrlnlvqrnvnifkfiipn
    vvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhal
    schgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevik
    lkgyttwaiglsvadlaesimknlrrvhpistmlkglygikedvflsvpcvlgqngisdv
    vkvtltseeeahlkksadtlwgiqkelqf