PDB entry 4i9b

View 4i9b on RCSB PDB site
Description: Structure of aminoaldehyde dehydrogenase 1 from Solanum lycopersium (SlAMADH1) with a thiohemiacetal intermediate
Class: oxidoreductase
Keywords: ALDH10 family fold, OXIDOREDUCTASE
Deposited on 2012-12-05, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative betaine aldehyde dehyrogenase
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: Solyc06g071290.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9ba_
  • Chain 'B':
    Compound: Putative betaine aldehyde dehyrogenase
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: Solyc06g071290.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i9bb_
  • Heterogens: NAD, NA, PEG, EDO, 1KA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i9bA (A:)
    mgsshhhhhhsqdpanrnvpiprrqlyiggewrepvkknripiinpateeiigdipaata
    edvdiaveaarkaiarddwgsttgaqrakylraiaakvlekksvlatlesldsgktlyes
    aadmddvagcfeyyaglaealdsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllm
    aiwkvapalaagcaailkpselasitclelgeicreiglpsgalniltglgpeaggplas
    hphvdkisftgsgptgskimtaaaqlvkpvslelggkspivvfddidnldiaaewtlfgi
    fantgqvcsatsrlivqeniasafmdrllkwtknikisdpleedcklgpvvsagqyekvl
    kfisnaksegatilcggerpqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkt
    eeqaielandtkyglgaavmskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsg
    fgrdlgkwglenflnikqvteytsaeplafykspskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9bA (A:)
    vpiprrqlyiggewrepvkknripiinpateeiigdipaataedvdiaveaarkaiardd
    wgsttgaqrakylraiaakvlekksvlatlesldsgktlyesaadmddvagcfeyyagla
    ealdsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllmaiwkvapalaagcaailk
    pselasitclelgeicreiglpsgalniltglgpeaggplashphvdkisftgsgptgsk
    imtaaaqlvkpvslelggkspivvfddidnldiaaewtlfgifantgqvcsatsrlivqe
    niasafmdrllkwtknikisdpleedcklgpvvsagqyekvlkfisnaksegatilcgge
    rpqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkteeqaielandtkyglgaa
    vmskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsgfgrdlgkwglenflnikq
    vteytsaeplafyksp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i9bB (B:)
    mgsshhhhhhsqdpanrnvpiprrqlyiggewrepvkknripiinpateeiigdipaata
    edvdiaveaarkaiarddwgsttgaqrakylraiaakvlekksvlatlesldsgktlyes
    aadmddvagcfeyyaglaealdsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllm
    aiwkvapalaagcaailkpselasitclelgeicreiglpsgalniltglgpeaggplas
    hphvdkisftgsgptgskimtaaaqlvkpvslelggkspivvfddidnldiaaewtlfgi
    fantgqvcsatsrlivqeniasafmdrllkwtknikisdpleedcklgpvvsagqyekvl
    kfisnaksegatilcggerpqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkt
    eeqaielandtkyglgaavmskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsg
    fgrdlgkwglenflnikqvteytsaeplafykspskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i9bB (B:)
    vpiprrqlyiggewrepvkknripiinpateeiigdipaataedvdiaveaarkaiardd
    wgsttgaqrakylraiaakvlekksvlatlesldsgktlyesaadmddvagcfeyyagla
    ealdsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllmaiwkvapalaagcaailk
    pselasitclelgeicreiglpsgalniltglgpeaggplashphvdkisftgsgptgsk
    imtaaaqlvkpvslelggkspivvfddidnldiaaewtlfgifantgqvcsatsrlivqe
    niasafmdrllkwtknikisdpleedcklgpvvsagqyekvlkfisnaksegatilcgge
    rpqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkteeqaielandtkyglgaa
    vmskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsgfgrdlgkwglenflnikq
    vteytsaeplafyksp