PDB entry 4i8q

View 4i8q on RCSB PDB site
Description: Structure of the aminoaldehyde dehydrogenase 1 E260A mutant from Solanum lycopersicum (SlAMADH1-E260A)
Class: oxidoreductase
Keywords: AMADH10 family fold, OXIDOREDUCTASE
Deposited on 2012-12-04, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative betaine aldehyde dehyrogenase
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: Solyc06g071290.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56R04 (Start-513)
      • engineered mutation (272)
    Domains in SCOPe 2.07: d4i8qa_
  • Heterogens: NAD, EDO, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i8qA (A:)
    mgsshhhhhhsqdpanrnvpiprrqlyiggewrepvkknripiinpateeiigdipaata
    edvdiaveaarkaiarddwgsttgaqrakylraiaakvlekksvlatlesldsgktlyes
    aadmddvagcfeyyaglaealdsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllm
    aiwkvapalaagcaailkpselasitclelgeicreiglpsgalniltglgpeaggplas
    hphvdkisftgsgptgskimtaaaqlvkpvslalggkspivvfddidnldiaaewtlfgi
    fantgqvcsatsrlivqeniasafmdrllkwtknikisdpleedcklgpvvsagqyekvl
    kfisnaksegatilcggerpqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkt
    eeqaielandtkyglgaavmskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsg
    fgrdlgkwglenflnikqvteytsaeplafyksp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8qA (A:)
    piprrqlyiggewrepvkknripiinpateeiigdipaataedvdiaveaarkaiarddw
    gsttgaqrakylraiaakvlekksvlatlesldsgktlyesaadmddvagcfeyyaglae
    aldsrrmtpvnlnsdsyksyvlreplgvvglitpwnypllmaiwkvapalaagcaailkp
    selasitclelgeicreiglpsgalniltglgpeaggplashphvdkisftgsgptgski
    mtaaaqlvkpvslalggkspivvfddidnldiaaewtlfgifantgqvcsatsrlivqen
    iasafmdrllkwtknikisdpleedcklgpvvsagqyekvlkfisnaksegatilcgger
    pqhlkkgyyvqptiitdvntsmeiwkeevfgpvlcvktfkteeqaielandtkyglgaav
    mskdvkrcerftkafqtgiiwincsqptfnelpwggkkrsgfgrdlgkwglenflnikqv
    teytsaeplafyksp