PDB entry 4i8p

View 4i8p on RCSB PDB site
Description: Crystal structure of aminoaldehyde dehydrogenase 1a from Zea mays (ZmAMADH1a)
Class: oxidoreductase
Keywords: ALDH10 family fold, OXIDOREDUCTASE
Deposited on 2012-12-04, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoaldehyde dehydrogenase 1
    Species: Zea mays [TaxId:4577]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8pa_
  • Chain 'B':
    Compound: Aminoaldehyde dehydrogenase 1
    Species: Zea mays [TaxId:4577]
    Gene: amadh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i8pb_
  • Heterogens: NAD, NA, GOL, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i8pA (A:)
    mgsshhhhhhsqdpnsaspamvplrqlfvdgewrppaqgrrlpvvnptteahigeipagt
    aedvdaavaaaraalkrnrgrdwarapgavrakylraiaakvierkpelaklealdcgkp
    ydeaawdmddvagcfeyfadqaealdkrqnspvslpmetfkchlrrepigvvglitpwny
    pllmatwkiapalaagctavlkpselasvtcleladickevglpsgvlnivtglgpdaga
    plsahpdvdkvaftgsfetgkkimasaapmvkpvtlelggkspivvfddvdidkavewtl
    fgcfwtngqicsatsrllihtkiakkfnermvawaknikvsdpleegcrlgpvvsegqye
    kikkfisnaksqgatiltggvrpahlekgffieptiitdittsmeiwreevfgpvlcvke
    fstedeaielandtqyglagavisgdrercqrlseeidagciwvncsqpcfcqapwggnk
    rsgfgrelgeggidnylsvkqvteyisdepwgwyqspskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8pA (A:)
    mvplrqlfvdgewrppaqgrrlpvvnptteahigeipagtaedvdaavaaaraalkrnrg
    rdwarapgavrakylraiaakvierkpelaklealdcgkpydeaawdmddvagcfeyfad
    qaealdkrqnspvslpmetfkchlrrepigvvglitpwnypllmatwkiapalaagctav
    lkpselasvtcleladickevglpsgvlnivtglgpdagaplsahpdvdkvaftgsfetg
    kkimasaapmvkpvtlelggkspivvfddvdidkavewtlfgcfwtngqicsatsrllih
    tkiakkfnermvawaknikvsdpleegcrlgpvvsegqyekikkfisnaksqgatiltgg
    vrpahlekgffieptiitdittsmeiwreevfgpvlcvkefstedeaielandtqyglag
    avisgdrercqrlseeidagciwvncsqpcfcqapwggnkrsgfgrelgeggidnylsvk
    qvteyisdepwgwyqspskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i8pB (B:)
    mgsshhhhhhsqdpnsaspamvplrqlfvdgewrppaqgrrlpvvnptteahigeipagt
    aedvdaavaaaraalkrnrgrdwarapgavrakylraiaakvierkpelaklealdcgkp
    ydeaawdmddvagcfeyfadqaealdkrqnspvslpmetfkchlrrepigvvglitpwny
    pllmatwkiapalaagctavlkpselasvtcleladickevglpsgvlnivtglgpdaga
    plsahpdvdkvaftgsfetgkkimasaapmvkpvtlelggkspivvfddvdidkavewtl
    fgcfwtngqicsatsrllihtkiakkfnermvawaknikvsdpleegcrlgpvvsegqye
    kikkfisnaksqgatiltggvrpahlekgffieptiitdittsmeiwreevfgpvlcvke
    fstedeaielandtqyglagavisgdrercqrlseeidagciwvncsqpcfcqapwggnk
    rsgfgrelgeggidnylsvkqvteyisdepwgwyqspskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8pB (B:)
    mvplrqlfvdgewrppaqgrrlpvvnptteahigeipagtaedvdaavaaaraalkrnrg
    rdwarapgavrakylraiaakvierkpelaklealdcgkpydeaawdmddvagcfeyfad
    qaealdkrqnspvslpmetfkchlrrepigvvglitpwnypllmatwkiapalaagctav
    lkpselasvtcleladickevglpsgvlnivtglgpdagaplsahpdvdkvaftgsfetg
    kkimasaapmvkpvtlelggkspivvfddvdidkavewtlfgcfwtngqicsatsrllih
    tkiakkfnermvawaknikvsdpleegcrlgpvvsegqyekikkfisnaksqgatiltgg
    vrpahlekgffieptiitdittsmeiwreevfgpvlcvkefstedeaielandtqyglag
    avisgdrercqrlseeidagciwvncsqpcfcqapwggnkrsgfgrelgeggidnylsvk
    qvteyisdepwgwyqsps