PDB entry 4i8n

View 4i8n on RCSB PDB site
Description: CRYSTAL STRUCTURE of PROTEIN TYROSINE PHOSPHATASE 1B IN COMPLEX WITH AN INHIBITOR [(4-{(2S)-2-(1,3-BENZOXAZOL-2-YL)-2-[(4-FLUOROPHENYL)SULFAMOYL]ETHYL}PHENYL)AMINO](OXO)ACETIC ACID
Class: hydrolase/hydrolase inhibitor
Keywords: PROTEIN PHOSPHATASE, PTP1B, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-12-03, released 2012-12-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.188
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4i8na_
  • Heterogens: 1CG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i8nA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmemekefeqidksgswaaiyqdirhe
    asdfpcrvaklpknknrnryrdvspfdhsriklhqedndyinaslikmeeaqrsyiltqg
    plpntcghfwemvweqksrgvvmlnrvmekgslkcaqywpqkeekemifedtnlkltlis
    ediksyytvrqlelenlttqetreilhfhyttwpdfgvpespasflnflfkvresgslsp
    ehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvdikkvllemrkfrmgliqtadq
    lrfsylaviegakfimgdssvqdqwkelshedlepppehipppprppkrileph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i8nA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedl