PDB entry 4i7h

View 4i7h on RCSB PDB site
Description: Structural basis for peroxide sensing and gene regulation by PerR from Streptococcus pyogenes
Class: transcription
Keywords: winged helix-turn-helix motif, oxidative stress sensing, metal homeostasis, DNA, TRANSCRIPTION
Deposited on 2012-11-30, released 2013-05-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxide stress sensing regulator
    Species: Streptococcus pyogenes [TaxId:198466]
    Gene: spf, SpyM3_0147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4i7ha_
  • Chain 'B':
    Compound: peroxide stress sensing regulator
    Species: Streptococcus pyogenes [TaxId:198466]
    Gene: spf, SpyM3_0147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4i7hb_
  • Heterogens: NI, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i7hA (A:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqakdqpdflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7hA (A:)
    dihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpnm
    slatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmdi
    akeaheqtgykvtripviaygicpdcq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i7hB (B:)
    mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
    mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
    iakeaheqtgykvtripviaygicpdcqakdqpdflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i7hB (B:)
    dihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpnm
    slatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmdi
    akeaheqtgykvtripviaygicpdcqa