PDB entry 4i6l

View 4i6l on RCSB PDB site
Description: Crystal structure of OTUB1 in complex with ubiquitin variant
Class: hydrolase
Keywords: deubiquitinase, HYDROLASE
Deposited on 2012-11-29, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.222
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin thioesterase OTUB1
    Species: Homo sapiens [TaxId:9606]
    Gene: OTUB1, OTB1, OTU1, HSPC263
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FW1 (2-228)
      • expression tag (0-1)
      • engineered mutation (48)
    Domains in SCOPe 2.06: d4i6la1, d4i6la2
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (2-End)
      • expression tag (0-1)
      • variant (43)
      • variant (45)
      • variant (48)
      • variant (63)
      • variant (67)
      • variant (69)
    Domains in SCOPe 2.06: d4i6lb1, d4i6lb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i6lA (A:)
    gsnplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgnsfyrafgfshle
    allddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasf
    ndqstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiia
    laqalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i6lA (A:)
    gsnplvserlelsvlykeydniyqqkikdlhkkysyirktrpdgnsfyrafgfshleall
    ddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndq
    stsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaq
    alsvsiqveymphifpegsepkvyllyrpghydilyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i6lB (B:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqkllfarkqledgrtlsd
    ynihkesflylvlrlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i6lB (B:)
    gsmqifvktltgktitlevepsdtienvkakiqdkegippdqqkllfarkqledgrtlsd
    ynihkesflylvlrl