SCOPe 2.08: Structural Classification of Proteins

PDB entry 4i3x

View 4i3x on RCSB PDB site
Description: Structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetate and cofactor NAD+
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, phosphonate catabolism, OXIDOREDUCTASE
Deposited on 2012-11-26, released 2013-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xa_
Chain 'B':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xb_
Chain 'C':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xc_
Chain 'D':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xd_
Chain 'E':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xe_
Chain 'F':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xf_
Chain 'G':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xg_
Chain 'H':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7 (Start-487)
Domains in SCOPe 2.08: d4i3xh_
Heterogens: NAD, PAE, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4i3xA (A:)
gshmtnaevtiavrhepmriagrlvdtddrvevrypwndtvvgtvpagraehareafaia
aayqpkltryerqkillataealaarkeeisdvitlelgiskadslyevgrafdvftlag
qmcirddgeifscdltphgkarkiftmrepltaisaitpfnhplnmvahkvapaiatnnc
vvvkpteltpmtallladilyeaglppemlsvvtgwpadigmemitnphvdlvtftgsvp
vgkliaanahykrqvlelggndpliilndlsdddlaraadlavagatknsgqrctavkri
lcqesvadrfvplvlerakrlrfgdpmdrstdlgtvihekaaalfeervmraaeegadil
yhpgrsgallppivvdrvphqsdlvleetfgpiipivrvpddddatitlsnstafglssg
vctndyrrmqkyiaglkvgtvniwevpgyriemspfggikdsgngykegvieamksftnv
ktfslpwp