SCOPe 2.05: Structural Classification of Proteins

PDB entry 4i3v

View 4i3v on RCSB PDB site
Description: Structure of phosphonoacetaldehyde dehydrogenase in complex with phosphonoacetaldehyde and cofactor NAD+
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, phosphonate catabolism, OXIDOREDUCTASE
Deposited on 2012-11-26, released 2013-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3va_
Chain 'B':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vb_
Chain 'C':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vc_
Chain 'D':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vd_
Chain 'E':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3ve_
Chain 'F':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vf_
Chain 'G':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vg_
Chain 'H':
Compound: Aldehyde dehydrogenase (NAD+)
Species: Sinorhizobium meliloti [TaxId:266834]
Gene: phnY, RB0979, SM_b21539
Database cross-references and differences (RAF-indexed):
- Uniprot Q92UV7
Domains in SCOPe 2.05: d4i3vh_
Heterogens: NAD, POA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4i3vA (A:)
gshmtnaevtiavrhepmriagrlvdtddrvevrypwndtvvgtvpagraehareafaia
aayqpkltryerqkillataealaarkeeisdvitlelgiskadslyevgrafdvftlag
qmcirddgeifscdltphgkarkiftmrepltaisaitpfnhplnmvahkvapaiatnnc
vvvkpteltpmtallladilyeaglppemlsvvtgwpadigmemitnphvdlvtftgsvp
vgkliaanahykrqvlelggndpliilndlsdddlaraadlavagatknsgqrctavkri
lcqesvadrfvplvlerakrlrfgdpmdrstdlgtvihekaaalfeervmraaeegadil
yhpgrsgallppivvdrvphqsdlvleetfgpiipivrvpddddatitlsnstafglssg
vctndyrrmqkyiaglkvgtvniwevpgyriemspfggikdsgngykegvieamksftnv
ktfslpwp