PDB entry 4i3q

View 4i3q on RCSB PDB site
Description: Crystal structure of human CYP3A4 coordinated to a water molecule
Class: oxidoreductase
Keywords: hemoprotein, monooxygenase, cytochrome P450 reductase, cytochrome b5, endoplasmic reticulum, cytochrome P450, OXIDOREDUCTASE
Deposited on 2012-11-26, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP3A4, CYP3A3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i3qa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i3qA (A:)
    maylygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqp
    vlaitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsg
    klkemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpq
    dpfventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesr
    ledtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimye
    lathpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkd
    veingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgpr
    ncigmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtv
    sgahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i3qA (A:)
    hshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdp
    dmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvp
    iiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfvent
    kkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkh
    rvdflqlmidsqnshkalsdlelvaqsiififagyettssvlsfimyelathpdvqqklq
    eeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgv
    vvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnm
    klalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrd