PDB entry 4i2x

View 4i2x on RCSB PDB site
Description: Crystal structure of Signal Regulatory Protein gamma (SIRP-gamma) in complex with FabOX117
Class: immune system
Keywords: Protein-Fab complex, Structural Genomics, Oxford Protein Production Facility, OPPF, Signal Regulatory Protein, CD47, cell surface, IMMUNE SYSTEM
Deposited on 2012-11-23, released 2013-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.199
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FabOX117 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2X (0-213)
    Domains in SCOPe 2.07: d4i2xa1, d4i2xa2
  • Chain 'B':
    Compound: FabOX117 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2X (0-228)
  • Chain 'C':
    Compound: FabOX117 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2X (0-213)
    Domains in SCOPe 2.07: d4i2xc1, d4i2xc2
  • Chain 'D':
    Compound: FabOX117 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4I2X (0-End)
  • Chain 'E':
    Compound: Signal-regulatory protein gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Signal-regulatory protein gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i2xA (A:)
    divitqspkfmstsvgdrvsitckasqdvstavawfqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhystpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4i2xC (C:)
    divitqspkfmstsvgdrvsitckasqdvstavawfqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhystpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.