PDB entry 4i2r

View 4i2r on RCSB PDB site
Description: 2.15 Angstroms X-ray crystal structure of NAD- and alternative substrate-bound 2-aminomuconate 6-semialdehyde dehydrogenase from Pseudomonas fluorescens
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, Dehydrogenase, NAD, OXIDOREDUCTASE
Deposited on 2012-11-22, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i2ra_
  • Chain 'B':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i2rb_
  • Chain 'C':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i2rc_
  • Chain 'D':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i2rd_
  • Heterogens: NAD, NA, 6OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i2rA (A:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2rA (A:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i2rB (B:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2rB (B:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i2rC (C:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2rC (C:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i2rD (D:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i2rD (D:)
    sqllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsv
    qdraalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktsht
    dlfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpsees
    pssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimka
    vadgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifde
    fvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfn
    derdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiw
    ttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianic
    iki