PDB entry 4i26

View 4i26 on RCSB PDB site
Description: 2.20 Angstroms X-ray crystal structure of 2-aminomuconate 6-semialdehyde dehydrogenase from Pseudomonas fluorescens
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, Dehydrogenase, OXIDOREDUCTASE
Deposited on 2012-11-21, released 2014-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i26a_
  • Chain 'B':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i26b_
  • Chain 'C':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i26c_
  • Chain 'D':
    Compound: 2-aminomuconate 6-semialdehyde dehydrogenase
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: nbaE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i26d_
  • Heterogens: EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i26A (A:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i26A (A:)
    qllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsvq
    draalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktshtd
    lfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpseesp
    ssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimkav
    adgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifdef
    vsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfnd
    erdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiwt
    tnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianici
    ki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i26B (B:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i26B (B:)
    qllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsvq
    draalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktshtd
    lfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpseesp
    ssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimkav
    adgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifdef
    vsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfnd
    erdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiwt
    tnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianici
    ki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i26C (C:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i26C (C:)
    llnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsvqd
    raalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktshtdl
    femstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpseesps
    satllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimkava
    dgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifdefv
    sglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfnde
    rdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiwtt
    nlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianicik
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i26D (D:)
    mntlpsqvwrtnigsapsqllnyidgnfvtsassfaninpvngklisdvfeadakqvnea
    vvaaqnalkgpwgklsvqdraalihkiadgiqarfeefvaaevadtgrpvhqartldipr
    aianfrtfadlaktshtdlfemstsdgsgalnytvrkplgvigvispwnlplllftwkva
    palacgntvvakpseespssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgis
    altftgesktgstimkavadgvkevsfelggknaavvfadadldaaiegvlrssftnsgq
    vclcservyvhrsifdefvsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrla
    vdegatvvtgggvpkfnderdqgayvqptiwtglsdkarcvteeifgpvchispfddede
    vinrvndsnyglacaiwttnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgr
    eggrfsmdfysdianiciki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i26D (D:)
    qllnyidgnfvtsassfaninpvngklisdvfeadakqvneavvaaqnalkgpwgklsvq
    draalihkiadgiqarfeefvaaevadtgrpvhqartldipraianfrtfadlaktshtd
    lfemstsdgsgalnytvrkplgvigvispwnlplllftwkvapalacgntvvakpseesp
    ssatllaevmhdagvppgvfnlihgfgkdsagefltqhpgisaltftgesktgstimkav
    adgvkevsfelggknaavvfadadldaaiegvlrssftnsgqvclcservyvhrsifdef
    vsglkveaerlvvgypdqdgvnmgplishghrdkvlsyyrlavdegatvvtgggvpkfnd
    erdqgayvqptiwtglsdkarcvteeifgpvchispfddedevinrvndsnyglacaiwt
    tnlsrahrvsrqihvglvwvntwylrdlrtpfggvklsglgreggrfsmdfysdianici
    ki