PDB entry 4i1v

View 4i1v on RCSB PDB site
Description: Crystal structure of a dephospho-CoA kinase from Burkholderia vietnamiensis bound to ADP
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, National Institute for Allergy and Infectious Disease, ATP-dependent, transferase, ADP, CoA, COD
Deposited on 2012-11-21, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Burkholderia vietnamiensis [TaxId:269482]
    Gene: Bcep1808_0550, coaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JBA9 (8-209)
      • expression tag (3-7)
    Domains in SCOPe 2.07: d4i1va1, d4i1va2
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Burkholderia vietnamiensis [TaxId:269482]
    Gene: Bcep1808_0550, coaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JBA9 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d4i1vb1, d4i1vb2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i1vA (A:)
    mahhhhhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqt
    fgpafvaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvp
    llvesrnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddv
    ivndaatpdalavqvdalhqrylafaaakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1vA (A:)
    hhhhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgp
    afvaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllv
    esrnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivn
    daatpdalavqvdalhqrylafaaakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i1vB (B:)
    mahhhhhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqt
    fgpafvaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvp
    llvesrnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddv
    ivndaatpdalavqvdalhqrylafaaakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1vB (B:)
    hmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafva
    adgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrn
    wkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaat
    pdalavqvdalhqrylafaaak