PDB entry 4i1u

View 4i1u on RCSB PDB site
Description: Apo crystal structure of a dephospho-CoA kinase from Burkholderia vietnamiensis
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, National Institute for Allergy and Infectious Disease, coenzyme A, biosynthesis, kinase, ATP-dependent, transferase
Deposited on 2012-11-21, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dephospho-coa kinase
    Species: Burkholderia vietnamiensis [TaxId:269482]
    Gene: Bcep1808_0550, coaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JBA9 (8-209)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d4i1ua1, d4i1ua2
  • Chain 'B':
    Compound: dephospho-coa kinase
    Species: Burkholderia vietnamiensis [TaxId:269482]
    Gene: Bcep1808_0550, coaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JBA9 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d4i1ub1, d4i1ub2
  • Heterogens: SO4, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i1uA (A:)
    mahhhhhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqt
    fgpafvaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvp
    llvesrnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddv
    ivndaatpdalavqvdalhqrylafaaakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1uA (A:)
    hhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpaf
    vaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllves
    rnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivnda
    atpdalavqvdalhqrylafaaakh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i1uB (B:)
    mahhhhhhmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqt
    fgpafvaadgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvp
    llvesrnwkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddv
    ivndaatpdalavqvdalhqrylafaaakh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1uB (B:)
    hmyaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafva
    adgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrn
    wkarcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaat
    pdalavqvdalhqrylafaaak