PDB entry 4i1o

View 4i1o on RCSB PDB site
Description: Crystal structure of the Legionella pneumophila GAP domain of LepB in complex with Rab1b bound to GDP and BeF3
Class: protein transport/hydrolase
Keywords: GAP, RabGAP, hydrolase activator, Rab1b, lpg2490, GTPase-activating proteins, hydrolysis, Rab1 hydrolase, GTP hydrolase, PROTEIN TRANSPORT-HYDROLASE complex
Deposited on 2012-11-21, released 2013-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0U4 (Start-174)
      • expression tag (175-180)
    Domains in SCOPe 2.05: d4i1oa_
  • Chain 'B':
    Compound: LepB
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lepB, lpg2490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSM7 (Start-301)
      • engineered mutation (140-141)
      • engineered mutation (143)
  • Chain 'C':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0U4 (Start-174)
      • expression tag (175-180)
    Domains in SCOPe 2.05: d4i1oc_
  • Chain 'D':
    Compound: LepB
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lepB, lpg2490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSM7 (Start-301)
      • engineered mutation (140-141)
      • engineered mutation (143)
  • Chain 'E':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0U4 (Start-174)
      • expression tag (175-180)
    Domains in SCOPe 2.05: d4i1oe_
  • Chain 'F':
    Compound: LepB
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lepB, lpg2490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSM7 (Start-301)
      • engineered mutation (140-141)
      • engineered mutation (143)
  • Chain 'G':
    Compound: Ras-related protein Rab-1B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0U4 (Start-174)
      • expression tag (175-180)
    Domains in SCOPe 2.05: d4i1og_
  • Chain 'H':
    Compound: LepB
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lepB, lpg2490
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZSM7 (Start-301)
      • engineered mutation (140-141)
      • engineered mutation (143)
  • Heterogens: MG, GDP, BEF, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i1oA (A:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlf
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1oA (A:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i1oC (C:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlf
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1oC (C:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4i1oE (E:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlf
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1oE (E:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4i1oG (G:)
    ghmpeydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktikl
    qiwdtagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllv
    gnksdlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlf
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1oG (G:)
    eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
    tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
    dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmglevlfq
    

  • Chain 'H':
    No sequence available.