PDB entry 4i1i

View 4i1i on RCSB PDB site
Description: Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin in complex with NAD
Class: oxidoreductase
Keywords: SSGCID, Leishmania major, Malate dehydrogenase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2012-11-21, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: cMDH, LMJF_28_2860
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4Q7X6 (21-344)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d4i1ia1, d4i1ia2, d4i1ia3
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: cMDH, LMJF_28_2860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4i1ib1, d4i1ib2
  • Heterogens: NAD, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i1iA (A:)
    mahhhhhhmgtleaqtqgpgsmsavkvavtgaagqigyalvpliargallgpttpvelrl
    ldiepalkalagveaeledcafplldkvvvtadprvafdgvaiaimcgafprkagmerkd
    llemnarifkeqgeaiaavaasdcrvvvvgnpantnalillksaqgklnprhvtamtrld
    hnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddaldddfv
    qvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsgl
    ifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1iA (A:)
    gsmsavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeled
    cafplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaav
    aasdcrvvvvgnpantnalillksaqgklnprhvtamtrldhnralsllarkagvpvsqv
    rnviiwgnhsstqvpdtdsavigttpareaikdfvqvvrgrgaeiiqlrglssamsaaka
    avdhvhdwihgtpegvyvsmgvysdenpygvpsglifsfpctchagewtvvsgklngdlg
    kqrlastiaelqeeraqagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i1iB (B:)
    mahhhhhhmgtleaqtqgpgsmsavkvavtgaagqigyalvpliargallgpttpvelrl
    ldiepalkalagveaeledcafplldkvvvtadprvafdgvaiaimcgafprkagmerkd
    llemnarifkeqgeaiaavaasdcrvvvvgnpantnalillksaqgklnprhvtamtrld
    hnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddaldddfv
    qvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsgl
    ifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i1iB (B:)
    savkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledcaf
    plldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaas
    dcrvvvvgnpantnalillksaqgklnprhvtamtrldhnralsllarkagvpvsqvrnv
    iiwgnhsstqvpdtdsavigttpaddfvqvvrgrgaeiiqlrglssamsaakaavdhvhd
    wihgtpegvyvsmgvysdenpygvpsglifsfpctchagewtvvsgklngdlgkqrlast
    iaelqeeraqagl