PDB entry 4i09

View 4i09 on RCSB PDB site
Description: structure of the mutant Catabolite gene activator protein V132L
Class: transcription
Keywords: DNA binding, TRANSCRIPTION
Deposited on 2012-11-16, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (143)
    Domains in SCOPe 2.06: d4i09a1, d4i09a2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (143)
    Domains in SCOPe 2.06: d4i09b1, d4i09b2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i09A (A:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtseklgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i09A (A:)
    pqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyl
    nqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrl
    qvtseklgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvg
    rilkmledqnlisahgktivvygt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i09B (B:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtseklgnlafldvtgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i09B (B:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    seklgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvygt