PDB entry 4i02

View 4i02 on RCSB PDB site
Description: structure of the mutant Catabolite gene activator protein V140A
Class: transcription
Keywords: DNA binding, TRANSCRIPTION
Deposited on 2012-11-16, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02a1, d4i02a2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8 (12-End)
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02b1, d4i02b2
  • Chain 'C':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02c1, d4i02c2
  • Chain 'D':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8 (12-End)
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02d1, d4i02d2
  • Chain 'E':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02e1, d4i02e2
  • Chain 'F':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: crp, cap, csm, b3357, JW5702
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACJ8
      • engineered mutation (151)
    Domains in SCOPe 2.06: d4i02f1, d4i02f2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4i02A (A:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02A (A:)
    lgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemil
    sylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqma
    rrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsre
    tvgrilkmledqnlisativvygt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4i02B (B:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02B (B:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisativvygt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4i02C (C:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02C (C:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvygt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4i02D (D:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02D (D:)
    mvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkem
    ilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaq
    marrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcs
    retvgrilkmledqnlisahtivvygt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4i02E (E:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02E (E:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvygt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4i02F (F:)
    mrgshhhhhhgsmvlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsv
    avlikdeegkemilsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliq
    vnpdilmrlsaqmarrlqvtsekvgnlafldatgriaqtllnlakqpdamthpdgmqiki
    trqeigqivgcsretvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4i02F (F:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldatgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgril
    kmledqnlisahgktivvygt