PDB entry 4hzr

View 4hzr on RCSB PDB site
Description: Crystal structure of Ack1 kinase domain
Class: transferase
Keywords: active state, phosphotransfer, TRANSFERASE
Deposited on 2012-11-15, released 2013-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.197
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzra_
  • Chain 'B':
    Compound: Activated CDC42 kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNK2, ACK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzrb_
  • Heterogens: SO4, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hzrA (A:)
    gsqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamd
    dfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsry
    avqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkv
    pfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlpr
    pedcpqdiynvmvqcwahkpedrptfvalrdflleaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzrA (A:)
    ltcligekdlrlleklgdgvvrrgewdapsgktvsvavkclamddfirevnamhsldhrn
    lirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrf
    ihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfs
    hasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcw
    ahkpedrptfvalrdflleaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hzrB (B:)
    gsqsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamd
    dfirevnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsry
    avqvaegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkv
    pfawcapeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlpr
    pedcpqdiynvmvqcwahkpedrptfvalrdflleaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzrB (B:)
    tcligekdlrlleklgvvrrgewdapsgktvsvavkceamddfirevnamhsldhrnlir
    lygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyleskrfihr
    dlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfshas
    dtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahk
    pedrptfvalrdflleaq