PDB entry 4hzm

View 4hzm on RCSB PDB site
Description: Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide
Class: hydrolase/hydrolase inhibitor
Keywords: TIM-BARREL, hydrolase-hydrolase inhibitor complex
Deposited on 2012-11-15, released 2013-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.17
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hzma_
  • Chain 'B':
    Compound: Beta-hexosaminidase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: nagZ, STM1209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hzmb_
  • Heterogens: 1BW, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hzmA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzmA (A:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavthketpcdp
    rpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdg
    vifsddlsmgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsf
    srrelmdsarwktasaqlnqlherwqeekag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hzmB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtadshketp
    cdprpetdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelg
    fdgvifsddlsmegaaimgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaerv
    trlyhkgsfsrrelmdsarwktasaqlnqlherwqeekaghgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hzmB (B:)
    mgpvmlnvegceldaeereilahplvgglilftrnyhdpeqlrelvrqiraasrnhlvva
    vdqeggrvqrfregftrlpaaqsffalhgleeggrlaqeagwlmasemiamdidisfapv
    ldvghisaaigersyhadpakalamatrfidgmhdagmkttgkhfpghgavtetpcdprp
    etdirgkdmsvfrtlisenkldaimpahviyraidprpasgspywlktvlrqelgfdgvi
    fsddlsmgsyaeraqasldagcdmilvcnnrkgavsvldnlspikaervtrlyhkgsfsr
    relmdsarwktasaqlnqlherwqeekagh