PDB entry 4hzl

View 4hzl on RCSB PDB site
Description: Neutralizing antibody mAb#8 in complex with the Epitope II of HCV E2 envelope protein
Class: immune system
Keywords: Ig domain, neutralizing antibody, IMMUNE SYSTEM
Deposited on 2012-11-15, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.224
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HZL (0-221)
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HZL (0-216)
    Domains in SCOPe 2.07: d4hzlb1, d4hzlb2
  • Chain 'E':
    Compound: E2 envelop protein
    Species: Recombinant Hepatitis C virus H77(5'UTR-NS2)/JFH1_V787A,Q1247L [TaxId:1006431]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: E2 envelop protein
    Species: Recombinant Hepatitis C virus H77(5'UTR-NS2)/JFH1_V787A,Q1247L [TaxId:1006431]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HZL (0-221)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HZL (0-216)
    Domains in SCOPe 2.07: d4hzll1, d4hzll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzlB (B:)
    dvlmtqtplslpvslgdqasiscrssqslvhsdgntylewylqkpgqspnlliyklsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hzlL (L:)
    dvlmtqtplslpvslgdqasiscrssqslvhsdgntylewylqkpgqspnlliyklsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn