PDB entry 4hzi

View 4hzi on RCSB PDB site
Description: Crystal structure of the Leptospira interrogans ATPase subunit of an orphan ABC transporter
Class: transport protein
Keywords: ABC transporter superfamily, manganese uptake, transposon mutagenesis, TRANSPORT PROTEIN
Deposited on 2012-11-15, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABC transporter ATP-binding protein
    Species: Leptospira interrogans serovar Copenhageni [TaxId:267671]
    Gene: LIC_12079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzia_
  • Chain 'B':
    Compound: ABC transporter ATP-binding protein
    Species: Leptospira interrogans serovar Copenhageni [TaxId:267671]
    Gene: LIC_12079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hzib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hziA (A:)
    msyyhhhhhhlestslykkagsenlyfqgkinsllslekisykptgktildsvsfeiktn
    ehcvllgrngagkstlvnliygmiwatsgtirlfqetygeiaiqdlrkrigildssqqen
    siqrkltvkdtiltglfhtigyyrdpspeeetktlqilkdsdllskkdqlyntlssgekk
    kilflrsivnepdflimdepcssldltaredflgflkeyhskkkftslyithrpeeipdf
    yskavllkegkvihfgpieecfteknledlydiplqvqrientwsvipkqkrty
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hziA (A:)
    nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti
    rlfqetygeiaiqdlrkrigildssqrkltvkdtiltglfhtigyyrdpspeeetktlqi
    lkdsdllskkdqlyntlssgekkkilflrsivnepdflimdepcssldltaredflgflk
    eyhskkkftslyithrpeeipdfyskavllkegkvihfgpieecfteknledlydiplqv
    qrientwsvipkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hziB (B:)
    msyyhhhhhhlestslykkagsenlyfqgkinsllslekisykptgktildsvsfeiktn
    ehcvllgrngagkstlvnliygmiwatsgtirlfqetygeiaiqdlrkrigildssqqen
    siqrkltvkdtiltglfhtigyyrdpspeeetktlqilkdsdllskkdqlyntlssgekk
    kilflrsivnepdflimdepcssldltaredflgflkeyhskkkftslyithrpeeipdf
    yskavllkegkvihfgpieecfteknledlydiplqvqrientwsvipkqkrty
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hziB (B:)
    nsllslekisykptgktildsvsfeiktnehcvllgrngagkstlvnliygmiwatsgti
    rlfqetygeiaiqdlrkrigildssqrkltvkdtiltgldpspeeetktlqilkdsdlls
    kkdqlyntlssgekkkilflrsivnepdflimdepcssldltaredflgflkeyhskkkf
    tslyithrpeeipdfyskavllkegkvihfgpieecfteknledlydiplqvqrientws
    vipkq