PDB entry 4hyr

View 4hyr on RCSB PDB site
Description: Structure of putative Glucarate dehydratase from Acidaminococcus sp. D21 with unusual static disorder
Class: lyase
Keywords: Glucarate dehydratase, lyase, New York Structural Genomics Research Consortium, NYSGRC, Protein Structure Initiative, PSI-Biology
Deposited on 2012-11-14, released 2013-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.165
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Acidaminococcus sp. D21 [TaxId:563191]
    Gene: ACDG_00756
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0WBB5 (3-443)
      • expression tag (2)
    Domains in SCOPe 2.06: d4hyra1, d4hyra2, d4hyra3
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Acidaminococcus sp. D21 [TaxId:563191]
    Gene: ACDG_00756
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0WBB5 (3-443)
      • expression tag (2)
    Domains in SCOPe 2.06: d4hyrb1, d4hyrb2, d4hyrb3
  • Heterogens: EDO, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hyrA (A:)
    mslvpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkitt
    alenvsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcld
    llgkaldmpvcrllgagqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneea
    idaehvvalckaaknkygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhl
    ddavryvadmhgiltycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghsl
    esqavdiiladphfwtmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgey
    naldthwiwqegrerltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgar
    ndaitmqylipgwkfdakspclvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hyrA (A:)
    lvpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittal
    envsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcldll
    gkaldmpvcrllgagqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneeaid
    aehvvalckaaknkygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhldd
    avryvadmhgiltycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghsles
    qavdiiladphfwtmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgeyna
    ldthwiwqegrerltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgarnd
    aitmqylipgwkfdakspclvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hyrB (B:)
    mslvpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkitt
    alenvsdivvgtkvsdyrntllkvqaeldksgekdergaqtfdlrtgvhvltaieapcld
    llgkaldmpvcrllgagqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneea
    idaehvvalckaaknkygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhl
    ddavryvadmhgiltycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghsl
    esqavdiiladphfwtmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgey
    naldthwiwqegrerltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgar
    ndaitmqylipgwkfdakspclvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hyrB (B:)
    lvpvitkmevypvaghdsmllnlsgghapyftrniviltdsegntgvgevpggpkittal
    envsdivvgtkvsdyrntllkvqaeldksdlrtgvhvltaieapcldllgkaldmpvcrl
    lgagqqrdfvrflgylffvgdrkktdlpyqseedsdcewyrlrneeaidaehvvalckaa
    knkygfkdfklkggvlrgdeemkvikamkkafpdarmdldpngawhlddavryvadmhgi
    ltycedpcgaedgysgreimsefrrrtgfptatnmiatdwrqvghslesqavdiiladph
    fwtmngsvrvaqmchefgytwgshsnnhfdislamcvhvgaavpgeynaldthwiwqegr
    erltkeplkianggikvpdkpglgveidrdqvmkahelykkhclgarndaitmqylipgw
    kfdakspclvr