PDB entry 4hxa

View 4hxa on RCSB PDB site
Description: Crystal structure of 13D9 FAB
Class: immune system
Keywords: antibody, fab, immune system, carbohydrate, complementarity determining regions
Deposited on 2012-11-09, released 2013-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.217
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 13d9 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HXA (0-220)
  • Chain 'L':
    Compound: 13d9 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HXA (0-212)
    Domains in SCOPe 2.06: d4hxal1, d4hxal2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hxaL (L:)
    eevltqspaimsaspgekvtmtcsvsssvnymhwyqqksstspklwiydtsnlasgvpgr
    fsgsgsgisysltissmeaedvatyycfqgsgypltfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec