PDB entry 4hwy

View 4hwy on RCSB PDB site
Description: Trypanosoma brucei procathepsin B solved from 40 fs free-electron laser pulse data by serial femtosecond X-ray crystallography
Class: hydrolase
Keywords: Papain fold, Lysosomal cysteine protease, HYDROLASE
Deposited on 2012-11-09, released 2012-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine peptidase C (CPC)
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb927.6.560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hwya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hwyA (A:)
    mhlmracitfciastavvavnaalvaedapvlskafvdrvnrlnrgiwkakydgvmqnit
    lreakrlngvikknnnasilpkrrfteeearaplpssfdsaeawpncptipqiadqsacg
    scwavaaasamsdrfctmggvqdvhisagdllaccsdcgdgcnggdpdrawayfsstglv
    sdycqpypfphcshhskskngyppcsqfnfdtpkcnytcddptipvvnyrswtsyalqge
    ddymrelffrgpfevafdvyedfiaynsgvyhhvsgqylgghavrlvgwgtsngvpywki
    answntewgmdgyflirrgssecgiedggsagiplapnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hwyA (A:)
    edapvlskafvdrvnrlnrgiwkakydgvmqnitlreakrlngvikilpkrrfteeeara
    plpssfdsaeawpncptipqiadqsacgscwavaaasamsdrfctmggvqdvhisagdll
    accsdcgdgcnggdpdrawayfsstglvsdycqpypfphcshhskskngyppcsqfnfdt
    pkcnytcddptipvvnyrswtsyalqgeddymrelffrgpfevafdvyedfiaynsgvyh
    hvsgqylgghavrlvgwgtsngvpywkianswntewgmdgyflirrgssecgiedggsag
    iplapnta