PDB entry 4hwe

View 4hwe on RCSB PDB site
Description: Crystal structure of ectodomain 3 of the IL-13 receptor alpha1 in complex with a human neutralizing monoclonal antibody fragment
Class: immune system
Keywords: Fab, FNIII, IMMUNE SYSTEM
Deposited on 2012-11-07, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.178
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HWE
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4HWE (0-End)
    Domains in SCOPe 2.04: d4hwel1, d4hwel2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4hweL (L:)
    evvltqspgtlslspgeratlscrasqsisssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqyetfgqgtkveikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hweL (L:)
    evvltqspgtlslspgeratlscrasqsisssylawyqqkpgqaprlliygassratgip
    drfsgsgsgtdftltisrlepedfavyycqqyetfgqgtkveikrtvaapsvfifppsde
    qlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlsk
    adyekhkvyacevthqglsspvtksfnrge