PDB entry 4hw0

View 4hw0 on RCSB PDB site
Description: Crystal structure of Sso10a-2, a DNA-binding protein from Sulfolobus solfataricus
Class: DNA binding protein
Keywords: Winged-helix, DNA-binding domain, two-stranded antiparallel coiled-coil, DNA/RNA-binding 3-helical bundle, DNA BINDING PROTEIN
Deposited on 2012-11-07, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein Sso10a-2
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: AAK42937.1, SSO2827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hw0a_
  • Chain 'B':
    Compound: DNA-binding protein Sso10a-2
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: AAK42937.1, SSO2827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hw0b_
  • Chain 'C':
    Compound: DNA-binding protein Sso10a-2
    Species: Sulfolobus solfataricus [TaxId:273057]
    Gene: AAK42937.1, SSO2827
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4hw0c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4hw0A (A:)
    mqlerrkrgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalnikten
    drkiyeitekgkllrthieefikirenlysakekvsellrtdse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hw0A (A:)
    krgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiye
    itekgkllrthieefikirenlysakekvsellrtdse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4hw0B (B:)
    mqlerrkrgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalnikten
    drkiyeitekgkllrthieefikirenlysakekvsellrtdse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hw0B (B:)
    rgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiyei
    tekgkllrthieefikirenlysakekvsellrtd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4hw0C (C:)
    mqlerrkrgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalnikten
    drkiyeitekgkllrthieefikirenlysakekvsellrtdse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4hw0C (C:)
    rgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiyei
    tekgkllrthieefikirenlysakekvsellr