PDB entry 4hus

View 4hus on RCSB PDB site
Description: Crystal structure of streptogramin group A antibiotic acetyltransferase VatA from Staphylococcus aureus in complex with virginiamycin M1
Class: transferase/antibiotic
Keywords: STRUCTURAL GENOMICS, ANTIBIOTIC RESISTANCE, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES (CSGID), NIAID, NATIONAL INSTITUTE OF ALLERGY AND INFECTIOUS DISEASES, XENOBIOTIC ACYLTRANSFERASE (XAT) FAMILY, HEXAPEPTIDE REPEAT ACYLTRANSFERASE, streptogramin group A antibiotic acetyltransferase, STREPTOGRAMIN GROUP A ANTIBIOTICS, STREPTOGRAMIN A, VIRGINIAMYCIN M1, DALFOPRISTIN, ACETYL COENZYME A, COENZYME A, INTRACELLULAR, TRANSFERASE-ANTIBIOTIC complex
Deposited on 2012-11-03, released 2012-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.186
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4husa_
  • Chain 'B':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4husb_
  • Chain 'C':
    Compound: Virginiamycin A acetyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: vat
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4husc_
  • Heterogens: SO4, NA, CL, EDO, PEG, VIR, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4husA (A:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4husA (A:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrklldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4husB (B:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4husB (B:)
    dhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdk
    liigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndv
    wigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalq
    wwnldmkiinenlpfiingdiemlkrkrkllddt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4husC (C:)
    gmnlnndhgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhy
    evigdkliigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdi
    eigndvwigrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvie
    ewlalqwwnldmkiinenlpfiingdiemlkrkrkllddt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4husC (C:)
    hgpdpenilpikgnrnlqfikptitnenilvgeysyydskrgesfedqvlyhyevigdkl
    iigrfcsigpgttfimnganhrmdgstypfhlfrmgwekympslkdlplkgdieigndvw
    igrdvtimpgvkigdgaiiaaeavvtknvapysivggnplkfirkrfsdgvieewlalqw
    wnldmkiinenlpfiingdiemlkrkrkl